PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10435380g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 515aa    MW: 57004.4 Da    PI: 5.7337
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10435380g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.14e-131966148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEd++l+++  + G g+W+ +a   g+ R++k+c++ w +yl
  MA_10435380g0010 19 KGLWSPEEDDKLIKYMMKNGRGCWSDVAMQAGLQRCGKSCRLSWINYL 66
                      678*******************************************97 PP

2Myb_DNA-binding48.22.5e-1572115146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+++++E++l+++++  lG + W+ Ia++++ gRt++++k++w++
  MA_10435380g0010  72 RGAFSPQEEQLIIHLHSILGHR-WSQIAARLP-GRTDNEIKNFWNS 115
                       89******************99.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-221369IPR009057Homeodomain-like
PROSITE profilePS5129415.6551466IPR017930Myb domain
SuperFamilySSF466892.62E-2616113IPR009057Homeodomain-like
SMARTSM007172.5E-101868IPR001005SANT/Myb domain
PfamPF002492.7E-121966IPR001005SANT/Myb domain
CDDcd001676.35E-92266No hitNo description
PROSITE profilePS5129424.88467121IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2570122IPR009057Homeodomain-like
SMARTSM007171.3E-1471119IPR001005SANT/Myb domain
PfamPF002493.0E-1472115IPR001005SANT/Myb domain
CDDcd001679.47E-1174114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MSCTAGGLPS PISKPKLRKG LWSPEEDDKL IKYMMKNGRG CWSDVAMQAG LQRCGKSCRL  60
SWINYLRPDL KRGAFSPQEE QLIIHLHSIL GHRWSQIAAR LPGRTDNEIK NFWNSCIKKK  120
LKHLSASNNN SKSICASNRT NTMNSSMTPF SESSAQPLEV MPTRYQPPNA FNHEVPTAEN  180
QFCIPDVLAL RHEQVQNQNQ FSIDQDSATN NLISQLWNSN SISVSTHESF SHAFMSPSLQ  240
AQGHAIKTPI KPCDQISWST PLTREAADSH ACNYSLGCSI PALVESESLK DKFKNDAGDQ  300
INENEIIYSS TASSVITAWS TNSYSDAEYC TVDPHDQVGS ILEDYVSHEK TTDQPCPPLN  360
SSLQFGAPAI RWTADGSNDE EYDCKDRLNL RYDVNLAYPN STNDKQNGYQ LPQIGGGVNG  420
DQWDCARIPN MEEANSTTPT STILGGSGQF EFECDGDAGG QVTAWAHDVM YNDIHTAASD  480
LLGTIDKFEA VSLRQRISVK RDVAGAKGMK FNLLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26151213108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1078830.0BT107883.1 Picea glauca clone GQ03113_N22 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB1PPT60.0B1PPT6_PINPS; R2R3-Myb4 transcription factor (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.18e-63myb domain protein 46